ALDH1A1 monoclonal antibody (M05), clone 1G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ALDH1A1.
Immunogen
ALDH1A1 (AAH01505, 1 a.a. ~ 501 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (80.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ALDH1A1 expression in transfected 293T cell line by ALDH1A1 monoclonal antibody (M05), clone 1G6.
Lane 1: ALDH1A1 transfected lysate (Predicted MW: 54.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ALDH1A1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of ALDH1A1 transfected lysate using anti-ALDH1A1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ALDH1A1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALDH1A1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — ALDH1A1
Entrez GeneID
216GeneBank Accession#
BC001505Protein Accession#
AAH01505Gene Name
ALDH1A1
Gene Alias
ALDC, ALDH-E1, ALDH1, ALDH11, MGC2318, PUMB1, RALDH1
Gene Description
aldehyde dehydrogenase 1 family, member A1
Gene Ontology
HyperlinkGene Summary
This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. [provided by RefSeq
Other Designations
ALDH class 1|acetaldehyde dehydrogenase 1|aldehyde dehydrogenase 1, soluble|aldehyde dehydrogenase 1A1|aldehyde dehydrogenase, liver cytosolic|retinal dehydrogenase 1|retinaldehyde dehydrogenase 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Effect of ALDH1A1 and CD44 on Survival and Disease Recurrence in Patients With Osteosarcoma.
Max R. Haffner, Augustine M. Saiz Jr., Morgan A. Darrow, Sean J. Judge, Tammy Laun, Aman Arora, Sandra L. Taylor, R Lor Randall, Elysia M. Alvarez, Steven W. Thorpe.
Cureus 2024 Jan; 16(1):e52404.
Application:IHC, Human, Osteosarcoma cancer stem cells.
-
The Presence and Potential Role of ALDH1A2 in the Glioblastoma Microenvironment.
Stephanie Sanders, Denise M Herpai, Analiz Rodriguez, Yue Huang, Jeff Chou, Fang-Chi Hsu, Darren Seals, Ryan Mott, Lance D Miller, Waldemar Debinski.
Cells 2021 Sep; 10(9):2485.
Application:WB-Ce, Human, THP-1 cells.
-
Effect of ALDH1A1 and CD44 on Survival and Disease Recurrence in Patients With Osteosarcoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com