NAT1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human NAT1 full-length ORF ( NP_000653.3, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
60.3
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NAT1
Entrez GeneID
9GeneBank Accession#
NM_000662.4Protein Accession#
NP_000653.3Gene Name
NAT1
Gene Alias
AAC1, NATI
Gene Description
N-acetyltransferase 1 (arylamine N-acetyltransferase)
Omim ID
108345Gene Ontology
HyperlinkGene Summary
This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human geneome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
N-acetyltransferase 1|OTTHUMP00000122488|arylamide acetylase 1 (N-acetyltransferase 1)|arylamine N-acetyltransferase 1
-
Interactomes
-
Pathways
-
Diseases
- Abnormalities
- Adenocarcinoma
- Adenoma
- Alcoholism
- Alzheimer disease
- Amnesia
- Asthma
- Breast cancer
- Breast Neoplasms
+ View More Disease
-
Publication Reference
-
Elucidation of xenobiotic metabolism pathways in human skin and human skin models by proteomic profiling.
van Eijl S, Zhu Z, Cupitt J, Gierula M, Götz C, Fritsche E, Edwards RJ.
PLoS One 2012 Jul; 7(7):e41721.
Application：WB, Human, Human whole skin microsomal fraction.
-
Phenotype of the Most Common "Slow Acetylator" Arylamine N-Acetyltransferase 1 Genetic Variant (NAT1*14B) is Substrate-Dependent.
Millner LM, Doll MA, Cai J, States JC, Hein DW.
Drug Metabolism and Disposition 2012 Jan; 40(1):198.
Application：WB-Tr, Mouse, UV5/1A1 cells.
-
Elucidation of xenobiotic metabolism pathways in human skin and human skin models by proteomic profiling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com