FAM50A monoclonal antibody (M02), clone 5F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FAM50A.
Immunogen
FAM50A (NP_004690, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FAM50A monoclonal antibody (M02), clone 5F10 Western Blot analysis of FAM50A expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
FAM50A monoclonal antibody (M02), clone 5F10. Western Blot analysis of FAM50A expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FAM50A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAM50A is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — FAM50A
Entrez GeneID
9130GeneBank Accession#
NM_004699Protein Accession#
NP_004690Gene Name
FAM50A
Gene Alias
9F, DXS9928E, HXC-26, XAP5
Gene Description
family with sequence similarity 50, member A
Omim ID
300453Gene Ontology
HyperlinkGene Summary
This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq
Other Designations
OTTHUMP00000032117|OTTHUMP00000061460|XAP-5 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com