HIRIP3 monoclonal antibody (M01), clone 3B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HIRIP3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 0.7 ug/ml]
Western Blot detection against Immunogen (37.99 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HIRIP3.
Immunogen
HIRIP3 (NP_003600, 447 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSCCSHKERLSILRAELEALGMKGTPSLGKCRALKEQREEAAEVASLDVANIISGSGRPRRRTAWNPLGEAAPPGELYRRTLDSDEERPRPAPPDWSHMRGIISSDGE*
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HIRIP3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 0.7 ug/ml]ELISA
-
Gene Info — HIRIP3
Entrez GeneID
8479GeneBank Accession#
NM_003609Protein Accession#
NP_003600Gene Name
HIRIP3
Gene Alias
-
Gene Description
HIRA interacting protein 3
Omim ID
603365Gene Ontology
HyperlinkGene Summary
The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of a multiprotein complex. Recently, several cDNAs encoding HIRA-interacting proteins, or HIRIPs, have been identified. In vitro, the HIRIP3 gene product binds HIRA, as well as H2B and H3 core histones, indicating that a complex containing HIRA-HIRIP3 could function in some aspects of chromatin and histone metabolism. [provided by RefSeq
Other Designations
HIRA-interacting protein 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com