NUDT1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human NUDT1 protein.
Immunogen
NUDT1 (NP_002443, 1 a.a. ~ 156 a.a) full-length human protein.
Sequence
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NUDT1 expression in transfected 293T cell line (H00004521-T01) by NUDT1 MaxPab polyclonal antibody.
Lane 1: NUDT1 transfected lysate(17.16 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NUDT1
Entrez GeneID
4521GeneBank Accession#
NM_002452Protein Accession#
NP_002443Gene Name
NUDT1
Gene Alias
MTH1
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 1
Omim ID
600312Gene Ontology
HyperlinkGene Summary
Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq
Other Designations
7,8-dihydro-8-oxoguanine triphosphatase|8-oxo-7,8-dihydrodeoxyguanosine triphosphatase|8-oxo-7,8-dihydroguanosine triphosphatase|8-oxo-dGTPase|OTTHUMP00000024690|OTTHUMP00000115537|OTTHUMP00000115538|OTTHUMP00000115539|OTTHUMP00000115540|mutT human homolo
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com