BAG1 monoclonal antibody (M02), clone 2D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BAG1.
Immunogen
BAG1 (NP_004314, 241 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in LNCaP ( Cat # L004V1 ).Western Blot (Cell lysate)
BAG1 monoclonal antibody (M02), clone 2D3 Western Blot analysis of BAG1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BAG1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BAG1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to BAG1 on HeLa cell. [antibody concentration 35 ug/ml] -
Gene Info — BAG1
Entrez GeneID
573GeneBank Accession#
NM_004323Protein Accession#
NP_004314Gene Name
BAG1
Gene Alias
RAP46
Gene Description
BCL2-associated athanogene
Omim ID
601497Gene Ontology
HyperlinkGene Summary
The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least three protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site, and alternative, downstream, AUG translation initiation sites. [provided by RefSeq
Other Designations
BCL2-associated athanogene 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com